PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G02320.2
Common NameATMYB3R5, MYB3R-5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 548aa    MW: 61731.5 Da    PI: 8.4448
Description myb domain protein 3r-5
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G02320.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.6e-1875121148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEde l +av+++ g++Wk+Ia+ ++  Rt+ qc +rwqk+l
      AT5G02320.2  75 KGGWTPEEDETLRRAVEKYKGKRWKKIAEFFP-ERTEVQCLHRWQKVL 121
                      688*****************************.************986 PP

2Myb_DNA-binding61.91.3e-19127173148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd+++v++vk++G+  W+ Ia+ ++ gR +kqc++rw+++l
      AT5G02320.2 127 KGPWTQEEDDKIVELVKKYGPAKWSVIAKSLP-GRIGKQCRERWHNHL 173
                      79******************************.*************97 PP

3Myb_DNA-binding48.32.3e-15179222146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT eE+  l + ++++G++ W+ Ia+ ++ gRt++ +k++w++
      AT5G02320.2 179 KDAWTVEEESALMNSHRMYGNK-WAEIAKVLP-GRTDNAIKNHWNS 222
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.54770121IPR017930Myb domain
SMARTSM007172.0E-1674123IPR001005SANT/Myb domain
PfamPF002492.1E-1675121IPR001005SANT/Myb domain
SuperFamilySSF466892.73E-1676131IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-2377133IPR009057Homeodomain-like
CDDcd001671.87E-1478121No hitNo description
PROSITE profilePS5129431.882122177IPR017930Myb domain
SuperFamilySSF466896.6E-32124220IPR009057Homeodomain-like
SMARTSM007173.9E-18126175IPR001005SANT/Myb domain
PfamPF002492.4E-18127173IPR001005SANT/Myb domain
CDDcd001672.89E-15129173No hitNo description
Gene3DG3DSA:1.10.10.601.0E-26134180IPR009057Homeodomain-like
SMARTSM007173.4E-15178226IPR001005SANT/Myb domain
PROSITE profilePS5129421.342178228IPR017930Myb domain
PfamPF002498.0E-14179222IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-22181228IPR009057Homeodomain-like
CDDcd001675.64E-11181224No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 548 aa     Download sequence    Send to blast
MSSSSNPPVC SPEKEERSEM KIEIQCMENK QPLAASCSSA SEGSGCFFLK SPEIATPATV  60
SSFPRRTSGP MRRAKGGWTP EEDETLRRAV EKYKGKRWKK IAEFFPERTE VQCLHRWQKV  120
LNPELVKGPW TQEEDDKIVE LVKKYGPAKW SVIAKSLPGR IGKQCRERWH NHLNPGIRKD  180
AWTVEEESAL MNSHRMYGNK WAEIAKVLPG RTDNAIKNHW NSSLKKKLEF YLATGNLPPP  240
ASKFIVLKDI ADGDRDSKQS SATKPFKDSD SLTQTSSGNT DSNEVGRDHF DSSSALLEEV  300
AASRRIGVNE YACSPVEYKP QLPNLEPISE EVRINSKAYF ERSIQRKVEN GFGTPKHGNL  360
YYKSPLDYYF PSEADLQHMY GYECGCSPGA ASPVSLMTTP CNKDSGLTAT RSPESFLREA  420
ARTFPNTPSI FRKRRKVVLA AKTDAVVVVN GVVKEVDRKE ESKDMRKSLL LETTDNCSDD  480
EELGLNGNAF NLSPPYRLRA KRTAVIKSRQ LEFTSEKEKQ PDNEIEFTSA KEKQPDNEIK  540
TSEEDKPV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-71742285159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-71742285159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible265301_s_at1e-107
Expression AtlasAT5G02320-
AtGenExpressAT5G02320-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative c-MYB-like transcription factor of the MYB3R factor gene family (MYB3R5).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G02320.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G02320
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196490.0AY519649.1 Arabidopsis thaliana MYB transcription factor (At5g02320) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001190206.10.0myb domain protein 3r-5
RefseqNP_568099.10.0myb domain protein 3r-5
TrEMBLQ6R0320.0Q6R032_ARATH; MYB transcription factor
STRINGAT5G02320.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  4. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Haga N, et al.
    R1R2R3-Myb proteins positively regulate cytokinesis through activation of KNOLLE transcription in Arabidopsis thaliana.
    Development, 2007. 134(6): p. 1101-10
    [PMID:17287251]